LOCUS P61320 207 aa linear BCT 25-JAN-2005 DEFINITION Outer-membrane lipoprotein lolB precursor. ACCESSION P61320 VERSION P61320 GI:47117716 DBSOURCE swissprot: locus LOLB_ECOLI, accession P61320; class: standard. extra accessions:P24208,Q46753,created: Mar 1, 1992. sequence updated: Nov 1, 1997. annotation updated: Jan 25, 2005. xrefs: gi: 147380, gi: 147381, gi: 216522, gi: 216524, gi: 968925, gi: 968928, gi: 48994873, gi: 1787460, gi: 1651596, gi: 1651599, gi: 477046, pdb accession 1IWN xrefs (non-sequence databases): EchoBASEEB1270, EcoGeneEG11293, HAMAPMF_00233, InterProIPR004565, InterProIPR000437, TIGRFAMsTIGR00548, PROSITEPS00013 KEYWORDS 3D-structure; Chaperone; Complete proteome; Direct protein sequencing; Lipoprotein; Outer membrane; Palmitate; Protein transport; Signal; Transport. SOURCE Escherichia coli ORGANISM Escherichia coli Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales; Enterobacteriaceae; Escherichia. REFERENCE 1 (residues 1 to 207) AUTHORS Ikemi,M., Murakami,K., Hashimoto,M. and Murooka,Y. TITLE Cloning and characterization of genes involved in the biosynthesis of delta-aminolevulinic acid in Escherichia coli JOURNAL Gene 121 (1), 127-132 (1992) PUBMED 1427085 REMARK NUCLEOTIDE SEQUENCE. REFERENCE 2 (residues 1 to 207) AUTHORS Post,D.A., Hove-Jensen,B. and Switzer,R.L. TITLE Characterization of the hemA-prs region of the Escherichia coli and Salmonella typhimurium chromosomes: identification of two open reading frames and implications for prs expression JOURNAL J. Gen. Microbiol. 139 (PT 2), 259-266 (1993) PUBMED 7679718 REMARK NUCLEOTIDE SEQUENCE. STRAIN=K12 REFERENCE 3 (residues 1 to 207) AUTHORS Strohmaier,H., Remler,P., Renner,W. and Hogenauer,G. TITLE Expression of genes kdsA and kdsB involved in 3-deoxy-D-manno-octulosonic acid metabolism and biosynthesis of enterobacterial lipopolysaccharide is growth phase regulated primarily at the transcriptional level in Escherichia coli K-12 JOURNAL J. Bacteriol. 177 (15), 4488-4500 (1995) PUBMED 7543480 REMARK NUCLEOTIDE SEQUENCE. STRAIN=K12 REFERENCE 4 (residues 1 to 207) AUTHORS Blattner,F.R., Plunkett,G. III, Bloch,C.A., Perna,N.T., Burland,V., Riley,M., Collado-Vides,J., Glasner,J.D., Rode,C.K., Mayhew,G.F., Gregor,J., Davis,N.W., Kirkpatrick,H.A., Goeden,M.A., Rose,D.J., Mau,B. and Shao,Y. TITLE The complete genome sequence of Escherichia coli K-12 JOURNAL Science 277 (5331), 1453-1474 (1997) PUBMED 9278503 REMARK NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. STRAIN=K12 / MG1655 REFERENCE 5 (residues 1 to 207) AUTHORS Oshima,T., Aiba,H., Baba,T., Fujita,K., Hayashi,K., Honjo,A., Ikemoto,K., Inada,T., Itoh,T., Kajihara,M., Kanai,K., Kashimoto,K., Kimura,S., Kitagawa,M., Makino,K., Masuda,S., Miki,T., Mizobuchi,K., Mori,H., Motomura,K., Nakamura,Y., Nashimoto,H., Nishio,Y., Saito,N., Sampei,G., Seki,Y., Tagami,H., Takemoto,K., Wada,C., Yamamoto,Y., Yano,M. and Horiuchi,T. TITLE A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map JOURNAL DNA Res. 3 (3), 137-155 (1996) PUBMED 8905232 REMARK NUCLEOTIDE SEQUENCE. STRAIN=K12 REFERENCE 6 (residues 1 to 207) AUTHORS Matsuyama,S., Yokota,N. and Tokuda,H. TITLE A novel outer membrane lipoprotein, LolB (HemM), involved in the LolA (p20)-dependent localization of lipoproteins to the outer membrane of Escherichia coli JOURNAL EMBO J. 16 (23), 6947-6955 (1997) PUBMED 9384574 REMARK CHARACTERIZATION, AND PARTIAL PROTEIN SEQUENCE. REFERENCE 7 (residues 1 to 207) AUTHORS Tanaka,K., Matsuyama,S.I. and Tokuda,H. TITLE Deletion of lolB, encoding an outer membrane lipoprotein, is lethal for Escherichia coli and causes accumulation of lipoprotein localization intermediates in the periplasm JOURNAL J. Bacteriol. 183 (22), 6538-6542 (2001) PUBMED 11673422 REMARK IMPORTANCE FOR VIABILITY. STRAIN=K12 REFERENCE 8 (residues 1 to 207) AUTHORS Takeda,K., Miyatake,H., Yokota,N., Matsuyama,S., Tokuda,H. and Miki,K. TITLE Crystal structures of bacterial lipoprotein localization factors, LolA and LolB JOURNAL EMBO J. 22 (13), 3199-3209 (2003) PUBMED 12839983 REMARK X-RAY CRYSTALLOGRAPHY (1.90 ANGSTROMS). COMMENT On May 11, 2004 this sequence version replaced gi:2507042. [FUNCTION] Plays a critical role in the incorporation of lipoproteins in the outer membrane after they are released by the lolA protein. Essential for E.coli viability. [SUBUNIT] Monomer. [SUBCELLULAR LOCATION] Attached to the outer membrane by a lipid anchor. [SIMILARITY] Belongs to the lolB family. [CAUTION] Was originally (Ref.1) thought to be involved in delta-aminolevulinic acid biosynthesis. ------------------------------------------------------------------- -------This Swiss-Prot entry is copyright. It is produced through a collaboration between the Swiss Institute of Bioinformatics and the EMBL outstation -the European Bioinformatics Institute. There are no restrictions on its use as long as its content is in no way modified and this statement is not removed. ------------------------------------------------------------------- -------. FEATURES Location/Qualifiers source 1..207 /organism="Escherichia coli" /db_xref="taxon:562" gene 1..207 /gene="lolB" /locus_tag="b1209" /note="synonym: hemM" Protein 1..207 /gene="lolB" /locus_tag="b1209" /product="Outer-membrane lipoprotein lolB precursor" Region 1..21 /gene="lolB" /locus_tag="b1209" /region_name="Signal" /evidence=experimental Region 12 /gene="lolB" /locus_tag="b1209" /region_name="Conflict" /note="L -> V (in Ref. 1)." /evidence=experimental Region 22..207 /gene="lolB" /locus_tag="b1209" /region_name="Mature chain" /note="Outer-membrane lipoprotein lolB." /evidence=experimental Site 22 /gene="lolB" /locus_tag="b1209" /site_type="lipid-binding" /note="N-palmitoyl cysteine." /evidence=experimental Site 22 /gene="lolB" /locus_tag="b1209" /site_type="lipid-binding" /note="S-diacylglycerol cysteine." /evidence=experimental Region 41..42 /gene="lolB" /locus_tag="b1209" /region_name="Conflict" /note="QH -> HD (in Ref. 3)." /evidence=experimental Region 176..207 /gene="lolB" /locus_tag="b1209" /region_name="Conflict" /note="YDTKTQPAMPANMELTDGGQRIKLKMDNWIVK -> MTPKR NLRCQPIWNSPTVVNASS (in Ref. 3)." /evidence=experimental ORIGIN 1 mplpdfrlir llplaalvlt acsvttpkgp gkspdspqwr qhqqdvrnln qyqtrgafay 61 isdqqkvyar ffwqqtgqdr yrllltnplg stelelnaqp gnvqlvdnkg qrytaddaee 121 migkltgmpi plnslrqwil glpgdatdyk lddqyrlsei tysqngknwk vvyggydtkt 181 qpampanmel tdggqriklk mdnwivk //