TBLASTN 2.2.10 [Oct-19-2004]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. RID: 1112626957-4625-188134086693.BLASTQ2 Query= gi|47117716|sp|P61320|LOLB_ECOLI Outer-membrane lipoprotein lolB precursor (207 letters) Database: Unfinished Campylobacter coli RM2228; Completed Campylobacter jejuni RM1221; Completed Campylobacter jejuni subsp. jejuni NCTC 11168; Unfinished Campylobacter lari RM2100; Unfinished Campylobacter upsaliensis RM3195; Completed Helicobacter hepaticus ATCC 51449; Completed Helicobacter pylori 26695; Completed Helicobacter pylori J99; Completed Wolinella succinogenes DSM 1740; 136 sequences; 21,035,363 total letters If you have any problems or questions with the results of this search please refer to the BLAST FAQs Taxonomy reports Score E Sequences producing significant alignments: (bits) Value ref|NC_003912.7| Campylobacter jejuni RM1221, complete genome 27 3.0 ref|NC_005090.1| Wolinella succinogenes DSM 1740, complete ... 27 3.0 ref|NC_002163.1| Campylobacter jejuni subsp. jejuni NCTC 11... 27 3.0 Alignments >ref|NC_003912.7| Campylobacter jejuni RM1221, complete genome Length = 1777831 Score = 26.6 bits (57), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 164 QNGKNWKVVYGGYDTKTQPAMPANM-ELT 191 Q+ KN ++Y Y +K P PAN ELT Sbjct: 1390203 QSQKNKNIIYVSYHSKEDPLTPANFKELT 1390117 >ref|NC_005090.1| Wolinella succinogenes DSM 1740, complete genome Length = 2110355 Score = 26.6 bits (57), Expect = 3.0 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -2 Query: 40 RQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPL--GSTELELN 97 R + D + +Q F Y SDQ+K F G LL+ + G TE+ +N Sbjct: 1191025 RAIRTDFPEIEIFQHSSGFVYTSDQEKSIREIFSDLEGGKVMDRLLSGDVGFGKTEVAMN 1190846 Query: 98 A 98 A Sbjct: 1190845 A 1190843 >ref|NC_002163.1| Campylobacter jejuni subsp. jejuni NCTC 11168, complete genome Length = 1641481 Score = 26.6 bits (57), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 164 QNGKNWKVVYGGYDTKTQPAMPANM-ELT 191 Q+ KN ++Y Y +K P PAN ELT Sbjct: 1235872 QSQKNKNIIYVSYHSKEDPLTPANFKELT 1235786
RID: 1112626957-4625-188134086693.BLASTQ2
Query= gi|47117716|sp|P61320|LOLB_ECOLI Outer-membrane lipoprotein lolB precursor (207 letters)
Database: Unfinished Campylobacter coli RM2228; Completed Campylobacter jejuni RM1221; Completed Campylobacter jejuni subsp. jejuni NCTC 11168; Unfinished Campylobacter lari RM2100; Unfinished Campylobacter upsaliensis RM3195; Completed Helicobacter hepaticus ATCC 51449; Completed Helicobacter pylori 26695; Completed Helicobacter pylori J99; Completed Wolinella succinogenes DSM 1740; 136 sequences; 21,035,363 total letters
If you have any problems or questions with the results of this search please refer to the BLAST FAQs
Taxonomy reports
Score E Sequences producing significant alignments: (bits) Value ref|NC_003912.7| Campylobacter jejuni RM1221, complete genome 27 3.0 ref|NC_005090.1| Wolinella succinogenes DSM 1740, complete ... 27 3.0 ref|NC_002163.1| Campylobacter jejuni subsp. jejuni NCTC 11... 27 3.0
>ref|NC_003912.7| Campylobacter jejuni RM1221, complete genome Length = 1777831 Score = 26.6 bits (57), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 164 QNGKNWKVVYGGYDTKTQPAMPANM-ELT 191 Q+ KN ++Y Y +K P PAN ELT Sbjct: 1390203 QSQKNKNIIYVSYHSKEDPLTPANFKELT 1390117
>ref|NC_005090.1| Wolinella succinogenes DSM 1740, complete genome Length = 2110355 Score = 26.6 bits (57), Expect = 3.0 Identities = 18/61 (29%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -2 Query: 40 RQHQQDVRNLNQYQTRGAFAYISDQQKVYARFFWQQTGQDRYRLLLTNPL--GSTELELN 97 R + D + +Q F Y SDQ+K F G LL+ + G TE+ +N Sbjct: 1191025 RAIRTDFPEIEIFQHSSGFVYTSDQEKSIREIFSDLEGGKVMDRLLSGDVGFGKTEVAMN 1190846 Query: 98 A 98 A Sbjct: 1190845 A 1190843
>ref|NC_002163.1| Campylobacter jejuni subsp. jejuni NCTC 11168, complete genome Length = 1641481 Score = 26.6 bits (57), Expect = 3.0 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 164 QNGKNWKVVYGGYDTKTQPAMPANM-ELT 191 Q+ KN ++Y Y +K P PAN ELT Sbjct: 1235872 QSQKNKNIIYVSYHSKEDPLTPANFKELT 1235786
Database: Unfinished Campylobacter coli RM2228; Unfinished Campylobacter lari RM2100; Unfinished Campylobacter upsaliensis RM3195 Posted date: Apr 2, 2005 8:04 PM Number of letters in database: -312,574,452 Number of sequences in database: 770,226 Lambda K H 0.316 0.134 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 3,595,524 Number of Sequences: 4896738 Number of extensions: 39295 Number of successful extensions: 139 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 17 Number of HSP's gapped (non-prelim): 129 length of query: 207 length of database: 7,011,906 effective HSP length: 93 effective length of query: 114 effective length of database: 6,999,258 effective search space: 797915412 effective search space used: 797915412 frameshift window, decay const: 40, 0.1 T: 13 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 57 (26.6 bits)
